HSP104 (Yeast) Recombinant Protein Ver mas grande

HSP104 (Yeast) Recombinant Protein

AB-P4985

Producto nuevo

HSP104 (Yeast) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 100 ug
Gene Name HSP104
Gene Alias -
Gene Description Heat shock protein that cooperates with Ydj1p (Hsp40) and Ssa1p (Hsp70) to refold and reactivate previously denatured, aggregated proteins
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MNDQTQFTERALTILTLAQKLASDHQHPQLQPIHILAAFIETPEDGSVPYLQNLIEKGRYDYDLFKKVVNRNLVRIPQQQPAPAEITPSYALGKVLQDAAKIQKQQKDSFIAQDHILFALFNDSSIQQIFKEAQVDIEAIKQQALELRGNTRIDSRGADTNTPLEYLSKYAIDMTEQARQGKLDPVIGREEEIRSTIRVLARRIKSNPCLIGEPGIGKTAIIEGVAQRIIDDDVPTILQGAKLFSLDLAALTAGA
Form Liquid
Antigen species Target species Yeast
Quality control testing Loading 3 ug protein in 10% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (2 mM EDTA, 5% glycerol).
Gene ID 850633

Más información

Yeast HSP104 (NP_013074, 1 a.a. - 908 a.a.) full-length recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

HSP104 (Yeast) Recombinant Protein

HSP104 (Yeast) Recombinant Protein