Ver mas grande
skp (iEscherichia coli/i) Recombinant protein
AB-P4982
Producto nuevo
skp (Escherichia coli) Recombinant protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | skp |
| Gene Alias | ECK0177|JW0173|hlpA|ompH |
| Gene Description | periplasmic chaperone |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMADKIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDVKDITADVLKQVK |
| Form | Liquid |
| Antigen species Target species | Escherichia coli |
| Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (20% glycerol). |
| Gene ID | 944861 |
Más información
Escherichia coli skp (NP_414720, 21 a.a. - 161 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.