AB-P4966
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Size | 100 ug |
Gene Name | dnaK |
Gene Alias | ECK0014|JW0013|groPAB|groPC|groPF|grpC|grpF|seg |
Gene Description | chaperone Hsp70, co-chaperone with DnaJ |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Concentration | 1 mg/mL |
Application Key | SDS-PAGE |
Immunogen Prot. Seq | MNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVKDKK |
Form | Liquid |
Antigen species Target species | Escherichia coli |
Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
Storage Buffer | In 25 mM Tris-HCl buffer, 100 mM NaCl, pH 7.5. (10% glycerol). |
Gene ID | 944750 |