dnaK (iEscherichia coli/i) Recombinant protein Ver mas grande

dnaK (iEscherichia coli/i) Recombinant protein

AB-P4963

Producto nuevo

dnaK (Escherichia coli) Recombinant protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 100 ug
Gene Name dnaK
Gene Alias ECK0014|JW0013|groPAB|groPC|groPF|grpC|grpF|seg
Gene Description chaperone Hsp70, co-chaperone with DnaJ
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLA
Form Liquid
Antigen species Target species Escherichia coli
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 25 mM Tris-HCl, 100 mM NaCl, pH 7.5 (5 mM DTT, 10% glycerol).
Gene ID 944750

Más información

Escherichia coli dnaK (NP_414555, 1 a.a. - 638 a.a.) full-length recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

dnaK (iEscherichia coli/i) Recombinant protein

dnaK (iEscherichia coli/i) Recombinant protein