p24 (HIV1) Recombinant Protein
  • p24 (HIV1) Recombinant Protein

p24 (HIV1) Recombinant Protein

Ref: AB-P4912
p24 (HIV1) Recombinant Protein

Información del producto

p24 (HIV1) (AAA44987, 155 a.a. - 321 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETL
Form Liquid
Antigen species Target species Viruses
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (0.1 mM PMSF, 10% glycerol).

Enviar un mensaje


p24 (HIV1) Recombinant Protein

p24 (HIV1) Recombinant Protein