UNC119B (Human) Recombinant Protein
  • UNC119B (Human) Recombinant Protein

UNC119B (Human) Recombinant Protein

Ref: AB-P4909
UNC119B (Human) Recombinant Protein

Información del producto

Human UNC119B (NP_001074002, 1 a.a. - 251 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name UNC119B
Gene Alias MGC5139
Gene Description unc-119 homolog B (C. elegans)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQELLALDTIRPEHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGRFVRYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFREHLLKNFDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDN
Form Liquid
Antigen species Target species Human
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID 84747

Enviar un mensaje


UNC119B (Human) Recombinant Protein

UNC119B (Human) Recombinant Protein