Ver mas grande
UNC119B (Human) Recombinant Protein
AB-P4909
Producto nuevo
UNC119B (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | UNC119B |
| Gene Alias | MGC5139 |
| Gene Description | unc-119 homolog B (C. elegans) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.5 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQELLALDTIRPEHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGRFVRYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFREHLLKNFDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDN |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol). |
| Gene ID | 84747 |
Más información
Human UNC119B (NP_001074002, 1 a.a. - 251 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.