LRPAP1 (Human) Recombinant Protein
  • LRPAP1 (Human) Recombinant Protein

LRPAP1 (Human) Recombinant Protein

Ref: AB-P4907
LRPAP1 (Human) Recombinant Protein

Información del producto

Human LRPAP1 (NP_002328, 35 a.a. - 357 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name LRPAP1
Gene Alias A2MRAP|A2RAP|HBP44|MGC138272|MRAP|RAP
Gene Description low density lipoprotein receptor-related protein associated protein 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1.0 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMYSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDLSDIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLA
Form Liquid
Antigen species Target species Human
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (20% glycerol, 1 mM DTT).
Gene ID 4043

Enviar un mensaje


LRPAP1 (Human) Recombinant Protein

LRPAP1 (Human) Recombinant Protein