Ver mas grande
CHMP4A (Human) Recombinant Protein
AB-P4906
Producto nuevo
CHMP4A (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | CHMP4A |
| Gene Alias | C14orf123|CHMP4|CHMP4B|HSPC134|MGC142093|MGC142095|SNF7|SNF7-1|Shax2 |
| Gene Description | chromatin modifying protein 4A |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.25 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMSRRRPEDGLGKAGPCVMRHHPPRSKAEVWRTLRGGGGRGELAMSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLP |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 20 mM Tris-HCl buffer, 200 mM NaCl, 1 mM EDTA, pH 8.0 (2 mM DTT, 50% glycerol, 0.1 mM PMSF). |
| Gene ID | 29082 |
Más información
Human CHMP4A (NP_054888, 1 a.a.- 265 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.