CHMP4A (Human) Recombinant Protein
  • CHMP4A (Human) Recombinant Protein

CHMP4A (Human) Recombinant Protein

Ref: AB-P4906
CHMP4A (Human) Recombinant Protein

Información del producto

Human CHMP4A (NP_054888, 1 a.a.- 265 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name CHMP4A
Gene Alias C14orf123|CHMP4|CHMP4B|HSPC134|MGC142093|MGC142095|SNF7|SNF7-1|Shax2
Gene Description chromatin modifying protein 4A
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.25 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMSRRRPEDGLGKAGPCVMRHHPPRSKAEVWRTLRGGGGRGELAMSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLP
Form Liquid
Antigen species Target species Human
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris-HCl buffer, 200 mM NaCl, 1 mM EDTA, pH 8.0 (2 mM DTT, 50% glycerol, 0.1 mM PMSF).
Gene ID 29082

Enviar un mensaje


CHMP4A (Human) Recombinant Protein

CHMP4A (Human) Recombinant Protein