HBsAg (ayw) Recombinant Protein
  • HBsAg (ayw) Recombinant Protein

HBsAg (ayw) Recombinant Protein

Ref: AB-P4875
HBsAg (ayw) Recombinant Protein

Información del producto

HBsAg (ayw) (CAA05872) full-length Recombinant protein expressed in yeast.
Información adicional
Size 50 ug
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
Form Liquid
Antigen species Target species Viruses
Storage Buffer In 50 mM phosphate buffer, 200 mM NaCl, pH7.2

Enviar un mensaje


HBsAg (ayw) Recombinant Protein

HBsAg (ayw) Recombinant Protein