eco (iEscherichia coli/i) Recombinant protein Ver mas grande

eco (iEscherichia coli/i) Recombinant protein

AB-P4873

Producto nuevo

eco (Escherichia coli) Recombinant protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 50 ug
Gene Name eco
Gene Alias ECK2201|JW2197|eti
Gene Description ecotin, a serine protease inhibitor
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMAESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Form Liquid
Antigen species Target species Escherichia coli
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris-HCl buffer, 50 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID 946700

Más información

Escherichia coli eco (NP_416713, 21 a.a. - 162 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.

Consulta sobre un producto

eco (iEscherichia coli/i) Recombinant protein

eco (iEscherichia coli/i) Recombinant protein