Tnf (Rat) Recombinant Protein
  • Tnf (Rat) Recombinant Protein

Tnf (Rat) Recombinant Protein

Ref: AB-P4852
Tnf (Rat) Recombinant Protein

Información del producto

Rat Tnf recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Tnf
Gene Alias MGC124630|RATTNF|TNF-alpha|Tnfa
Gene Description tumor necrosis factor (TNF superfamily, member 2)
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFATSYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVSQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from 5 mM Na2PO4, 50 mM NaCl, pH 7.5
Gene ID 24835

Enviar un mensaje


Tnf (Rat) Recombinant Protein

Tnf (Rat) Recombinant Protein