Ver mas grande
Tnf (Rat) Recombinant Protein
AB-P4852
Producto nuevo
Tnf (Rat) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Tnf |
| Gene Alias | MGC124630|RATTNF|TNF-alpha|Tnfa |
| Gene Description | tumor necrosis factor (TNF superfamily, member 2) |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFATSYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVSQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL |
| Form | Lyophilized |
| Antigen species Target species | Rat |
| Storage Buffer | Lyophilized from 5 mM Na<sub>2</sub>PO<sub>4</sub>, 50 mM NaCl, pH 7.5 |
| Gene ID | 24835 |
Más información
Rat Tnf recombinant protein expressed in Escherichia coli.