Ccl3 (Rat) Recombinant Protein
  • Ccl3 (Rat) Recombinant Protein

Ccl3 (Rat) Recombinant Protein

Ref: AB-P4849
Ccl3 (Rat) Recombinant Protein

Información del producto

Rat Ccl3 recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Ccl3
Gene Alias MIP-1a|Scya3
Gene Description chemokine (C-C motif) ligand 3
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA
Form Lyophilized
Antigen species Target species Rat
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer No additive
Gene ID 25542

Enviar un mensaje


Ccl3 (Rat) Recombinant Protein

Ccl3 (Rat) Recombinant Protein