GSK3B (Human) Recombinant Protein
  • GSK3B (Human) Recombinant Protein

GSK3B (Human) Recombinant Protein

Ref: AB-P4698
GSK3B (Human) Recombinant Protein

Información del producto

Human GSK3B (NP_001139628.1, 1 a.a.- 420 a.a.) full-length recombinant protein with GST-His tag expressed in Sf9 cells.
Información adicional
Size 100 ug
Gene Name GSK3B
Gene Alias -
Gene Description glycogen synthase kinase 3 beta
Storage Conditions Store at -80C.
Aliquot to avoid repeated freezing and thawing
Concentration 0.276 ug/Ul
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQP
Form Liquid
Antigen species Target species Human
Quality control testing 2 ug/lane SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 50 mM Hepes, 100 mM NaCl, pH 7.5. (5 mM DTT, 15 mM reduced glutathione, 20% glycerol)
Gene ID 2932

Enviar un mensaje


GSK3B (Human) Recombinant Protein

GSK3B (Human) Recombinant Protein