Retnlb (Mouse) Recombinant Protein Ver mas grande

Retnlb (Mouse) Recombinant Protein

AB-P4630

Producto nuevo

Retnlb (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 25 ug
Gene Name Retnlb
Gene Alias 9030012B21Rik|Fizz2|RELMbeta|Relmb|Xcp3
Gene Description resistin like beta
Storage Conditions Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA
Form Lyophilized
Antigen species Target species Mouse
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer No additive
Gene ID 57263

Más información

Mouse Retnlb (Q99P86) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Retnlb (Mouse) Recombinant Protein

Retnlb (Mouse) Recombinant Protein