Ver mas grande
Cxcl12 (Beta) (Mouse) Recombinant Protein
AB-P4628
Producto nuevo
Cxcl12 (Beta) (Mouse) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | Cxcl12 |
| Gene Alias | AI174028|PBSF|PBSF/SDF-1|SDF-1|Scyb12|Sdf1|Sdf1a|Sdf1b|TLSF|TLSF-a|TLSF-b|TPAR1 |
| Gene Description | chemokine (C-X-C motif) ligand 12 |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC or lower.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Storage Buffer | No additive |
| Gene ID | 20315 |
Más información
Mouse Cxcl12 (beta) (P40224-2) recombinant protein expressed in Escherichia coli.