Il17f (Mouse) Recombinant Protein
  • Il17f (Mouse) Recombinant Protein

Il17f (Mouse) Recombinant Protein

Ref: AB-P4625
Il17f (Mouse) Recombinant Protein

Información del producto

Mouse Il17f (Q7TN17) recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name Il17f
Gene Alias C87042|IL-17F
Gene Description interleukin 17F
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer No additive
Gene ID 257630

Enviar un mensaje


Il17f (Mouse) Recombinant Protein

Il17f (Mouse) Recombinant Protein