Ver mas grande
Ccl3 (Mouse) Recombinant Protein
AB-P4612
Producto nuevo
Ccl3 (Mouse) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | Ccl3 |
| Gene Alias | AI323804|G0S19-1|LD78alpha|MIP-1alpha|MIP1-(a)|MIP1-alpha|Mip1a|Scya3 |
| Gene Description | chemokine (C-C motif) ligand 3 |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Storage Buffer | No additive |
| Gene ID | 20302 |
Más información
Mouse Ccl3 (Q5QNW0) recombinant protein expressed in Escherichia coli.