Ccl7 (Mouse) Recombinant Protein
  • Ccl7 (Mouse) Recombinant Protein

Ccl7 (Mouse) Recombinant Protein

Ref: AB-P4611
Ccl7 (Mouse) Recombinant Protein

Información del producto

Mouse Ccl7 (Q03366.1) recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Ccl7
Gene Alias MCP-3|Scya7|fic|marc|mcp3
Gene Description chemokine (C-C motif) ligand 7
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
Form Lyophilized
Antigen species Target species Mouse
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer No additive
Gene ID 20306

Enviar un mensaje


Ccl7 (Mouse) Recombinant Protein

Ccl7 (Mouse) Recombinant Protein