Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
Cxcl10 (Mouse) Recombinant Protein
Abnova
Cxcl10 (Mouse) Recombinant Protein
Ref: AB-P4609
Cxcl10 (Mouse) Recombinant Protein
Contáctenos
Información del producto
Mouse Cxcl10 (P17515) recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
25 ug
Gene Name
Cxcl10
Gene Alias
C7|CRG-2|INP10|IP-10|IP10|Ifi10|Scyb10|gIP-10|mob-1
Gene Description
chemokine (C-X-C motif) ligand 10
Storage Conditions
Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Form
Lyophilized
Antigen species Target species
Mouse
Quality control testing
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer
No additive
Gene ID
15945
Enviar un mensaje
Cxcl10 (Mouse) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*