Vegfa (Mouse) Recombinant Protein
  • Vegfa (Mouse) Recombinant Protein

Vegfa (Mouse) Recombinant Protein

Ref: AB-P4608
Vegfa (Mouse) Recombinant Protein

Información del producto

Mouse Vegfa (165 amino acids) (AAA40547) recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Vegfa
Gene Alias Vegf|Vegf-a|Vegf120|Vegf164|Vegf188|Vpf
Gene Description vascular endothelial growth factor A
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Form Lyophilized
Antigen species Target species Mouse
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer No additive
Gene ID 22339

Enviar un mensaje


Vegfa (Mouse) Recombinant Protein

Vegfa (Mouse) Recombinant Protein