Ver mas grande
Retnla (Mouse) Recombinant Protein
AB-P4605
Producto nuevo
Retnla (Mouse) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | Retnla |
| Gene Alias | 1810019L16Rik|Fizz-1|Fizz1|HIMF|RELM-alpha|RELMa|RELMalpha|Xcp2 |
| Gene Description | resistin like alpha |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MDETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Storage Buffer | Lyophilized with 10 mM Na<sub>2</sub>PO<sub>4</sub>, pH 7.5. |
| Gene ID | 57262 |
Más información
Mouse Retnla (Q9EP95) recombinant protein expressed in Escherichia coli.