Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
Csf2 (Mouse) Recombinant Protein
Abnova
Csf2 (Mouse) Recombinant Protein
Ref: AB-P4595
Csf2 (Mouse) Recombinant Protein
Contáctenos
Información del producto
Mouse Csf2 (P01587) recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
20 ug
Gene Name
Csf2
Gene Alias
Csfgm|Gm-CSf|MGC151255|MGC151257|MGI-IGM
Gene Description
colony stimulating factor 2 (granulocyte-macrophage)
Storage Conditions
Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
Form
Lyophilized
Antigen species Target species
Mouse
Quality control testing
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer
Lyophilized with 10 mM acetic acid.
Gene ID
12981
Enviar un mensaje
Csf2 (Mouse) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*