Csf3 (Mouse) Recombinant Protein
  • Csf3 (Mouse) Recombinant Protein

Csf3 (Mouse) Recombinant Protein

Ref: AB-P4594
Csf3 (Mouse) Recombinant Protein

Información del producto

Mouse Csf3 (P09920) recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Csf3
Gene Alias Csfg|G-CSF|MGI-IG
Gene Description colony stimulating factor 3 (granulocyte)
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
Form Lyophilized
Antigen species Target species Mouse
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer No additive
Gene ID 12985

Enviar un mensaje


Csf3 (Mouse) Recombinant Protein

Csf3 (Mouse) Recombinant Protein