Ver mas grande
Ngf (Mouse) Recombinant Protein
AB-P4591
Producto nuevo
Ngf (Mouse) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Ngf |
| Gene Alias | Ngfb |
| Gene Description | nerve growth factor |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Storage Buffer | No additive |
| Gene ID | 18049 |
Más información
Mouse Ngf (Q6LDU8) recombinant protein expressed in Escherichia coli.