Igf1 (Mouse) Recombinant Protein
  • Igf1 (Mouse) Recombinant Protein

Igf1 (Mouse) Recombinant Protein

Ref: AB-P4585
Igf1 (Mouse) Recombinant Protein

Información del producto

Mouse Igf1 (Q8CAR0) recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name Igf1
Gene Alias C730016P09Rik|Igf-1|Igf-I
Gene Description insulin-like growth factor 1
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA
Form Lyophilized
Antigen species Target species Mouse
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer No additive
Gene ID 16000

Enviar un mensaje


Igf1 (Mouse) Recombinant Protein

Igf1 (Mouse) Recombinant Protein