Ver mas grande
Tnfsf11 (Mouse) Recombinant Protein
AB-P4584
Producto nuevo
Tnfsf11 (Mouse) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | Tnfsf11 |
| Gene Alias | Ly109l|ODF|OPG|OPGL|RANKL|Trance |
| Gene Description | tumor necrosis factor (ligand) superfamily, member 11 |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Storage Buffer | Lyophilized with 10 mM Na<sub>2</sub>PO<sub>4</sub>, 50 mM NaCl, pH 7.5. |
| Gene ID | 21943 |
Más información
Mouse Tnfsf11 (O35235) recombinant protein expressed in Escherichia coli.