Ver mas grande
IL17A (Human) Recombinant Protein
AB-P4579
Producto nuevo
IL17A (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | IL17A |
| Gene Alias | CTLA8|IL-17|IL-17A|IL17 |
| Gene Description | interleukin 17A |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Storage Buffer | No additive |
| Gene ID | 3605 |
Más información
Human IL17A (Q16552) recombinant protein expressed in Escherichia coli.