CXCL3 (Human) Recombinant Protein
  • CXCL3 (Human) Recombinant Protein

CXCL3 (Human) Recombinant Protein

Ref: AB-P4570
CXCL3 (Human) Recombinant Protein

Información del producto

Human CXCL3 (P19876) recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name CXCL3
Gene Alias CINC-2b|GRO3|GROg|MIP-2b|MIP2B|SCYB3
Gene Description chemokine (C-X-C motif) ligand 3
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized with 10 mM Na2PO4, pH 7.5.
Gene ID 2921

Enviar un mensaje


CXCL3 (Human) Recombinant Protein

CXCL3 (Human) Recombinant Protein