PHOSPHO2 (Human) Recombinant Protein
  • PHOSPHO2 (Human) Recombinant Protein

PHOSPHO2 (Human) Recombinant Protein

Ref: AB-P4541
PHOSPHO2 (Human) Recombinant Protein

Información del producto

Human PHOSPHO2 (NP_001008489, 1 a.a. - 241 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name PHOSPHO2
Gene Alias MGC111048|MGC22679
Gene Description phosphatase, orphan 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.25 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGRVFKYLGDKGVREHEMKRAVTSLPFTPGMVELFNFIRKNKDKFDCIIISDSNSVFIDWVLEAASFHDIFDKVFTNPAAFNSNGHLTVENYHTHSCNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVYIGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLEPMEYSVVVWSSGVDI
Form Liquid
Antigen species Target species Human
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (10% glycerol, 1 mM DTT).
Gene ID 493911

Enviar un mensaje


PHOSPHO2 (Human) Recombinant Protein

PHOSPHO2 (Human) Recombinant Protein