Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
GPX2 (Human) Recombinant Protein
Abnova
GPX2 (Human) Recombinant Protein
Ref: AB-P4538
GPX2 (Human) Recombinant Protein
Contáctenos
Información del producto
Human GPX2 (NP_002074, 1 a.a. - 190 a.a.) full-length recombinant protein with His tag expressed in
Escherichia coli
.
Información adicional
Size
10 ug
Gene Name
GPX2
Gene Alias
GI-GPx|GPRP|GSHPX-GI|GSHPx-2
Gene Description
glutathione peroxidase 2 (gastrointestinal)
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration
0.25 mg/mL
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLCGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI
Form
Liquid
Antigen species Target species
Human
Quality control testing
15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer
In 20 mM Tris-HCl buffer, 0.15 M NaCl, pH7.5 (40% glycerol, 1 mM DTT).
Gene ID
2877
Enviar un mensaje
GPX2 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*