Ver mas grande
VEGFA (Human) Recombinant Protein
AB-P4444
Producto nuevo
VEGFA (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | VEGFA |
| Gene Alias | MGC70609|VEGF|VEGF-A|VPF |
| Gene Description | vascular endothelial growth factor A |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC or lower.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | No additive |
| Gene ID | 7422 |
Más información
Human VEGFA (P15692-9) recombinant protein expressed in Escherichia coli.