SHH (Human) Recombinant Protein
  • SHH (Human) Recombinant Protein

SHH (Human) Recombinant Protein

Ref: AB-P4440
SHH (Human) Recombinant Protein

Información del producto

Human SHH (Q15465) recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name SHH
Gene Alias HHG1|HLP3|HPE3|MCOPCB5|SMMCI|TPT|TPTPS
Gene Description sonic hedgehog homolog (Drosophila)
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C or lower.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MIIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRALDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFP
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized from 10 mM Na2PO4, pH 7.5
Gene ID 6469

Enviar un mensaje


SHH (Human) Recombinant Protein

SHH (Human) Recombinant Protein