Ver mas grande
MSTN (Human) Recombinant Protein
AB-P4431
Producto nuevo
MSTN (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | MSTN |
| Gene Alias | GDF8 |
| Gene Description | myostatin |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with 20 mM HCl, store at -20ºC or lower.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | No additive |
| Gene ID | 2660 |
Más información
Human MSTN (O14793) recombinant protein expressed in Escherichia coli.