CCL8 (Human) Recombinant Protein
  • CCL8 (Human) Recombinant Protein

CCL8 (Human) Recombinant Protein

Ref: AB-P4423
CCL8 (Human) Recombinant Protein

Información del producto

Human CCL8 (P80075) recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name CCL8
Gene Alias HC14|MCP-2|MCP2|SCYA10|SCYA8
Gene Description chemokine (C-C motif) ligand 8
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C or lower.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer No additive
Gene ID 6355

Enviar un mensaje


CCL8 (Human) Recombinant Protein

CCL8 (Human) Recombinant Protein