Ver mas grande
IL21 (Human) Recombinant Protein
AB-P4412
Producto nuevo
IL21 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | IL21 |
| Gene Alias | IL-21|Za11 |
| Gene Description | interleukin 21 |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC or lower.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyopohilized from 20 mM Na<sub>2</sub>PO<sub>4</sub>, pH 7.5 |
| Gene ID | 59067 |
Más información
Human IL21 (Q9HBE4) recombinant protein expressed in Escherichia coli.