IL19 (Human) Recombinant Protein
  • IL19 (Human) Recombinant Protein

IL19 (Human) Recombinant Protein

Ref: AB-P4410
IL19 (Human) Recombinant Protein

Información del producto

Human IL19 (Q9UHD0) recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL19
Gene Alias IL-10C|MDA1|NG.1|ZMDA1
Gene Description interleukin 19
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C or lower.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized from 10 mM sodium citrate, pH 5.0
Gene ID 29949

Enviar un mensaje


IL19 (Human) Recombinant Protein

IL19 (Human) Recombinant Protein