Ver mas grande
IL11 (Human) Recombinant Protein
AB-P4405
Producto nuevo
IL11 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | IL11 |
| Gene Alias | AGIF|IL-11 |
| Gene Description | interleukin 11 |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC or lower.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Storage Buffer | Lyophilized from a sterile (0.2 micron) filtered aqueous solution (0.1% trifluoroacetic acid (TFA)). |
| Gene ID | 3589 |
Más información
Human IL11 (P20809) recombinant protein expressed in Escherichia coli.