IL10 (Human) Recombinant Protein
  • IL10 (Human) Recombinant Protein

IL10 (Human) Recombinant Protein

Ref: AB-P4404
IL10 (Human) Recombinant Protein

Información del producto

Human IL10 (P22301) recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL10
Gene Alias CSIF|IL-10|IL10A|MGC126450|MGC126451|TGIF
Gene Description interleukin 10
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C or lower.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 10 mM Na2PO4, pH 7.5
Gene ID 3586

Enviar un mensaje


IL10 (Human) Recombinant Protein

IL10 (Human) Recombinant Protein