Ver mas grande
IFNG (Human) Recombinant Protein
AB-P4400
Producto nuevo
IFNG (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | IFNG |
| Gene Alias | IFG|IFI |
| Gene Description | interferon, gamma |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC or lower.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 5 mM Na<sub>2</sub>PO<sub>4</sub>, 50 mM NaCl, pH 7.2 |
| Gene ID | 3458 |
Más información
Human IFNG (P01579) recombinant protein expressed in Escherichia coli.