IGF1 (Human) Recombinant Protein
  • IGF1 (Human) Recombinant Protein

IGF1 (Human) Recombinant Protein

Ref: AB-P4399
IGF1 (Human) Recombinant Protein

Información del producto

Human IGF1 (P05019) recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name IGF1
Gene Alias IGFI
Gene Description insulin-like growth factor 1 (somatomedin C)
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C or lower.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer No additive
Gene ID 3479

Enviar un mensaje


IGF1 (Human) Recombinant Protein

IGF1 (Human) Recombinant Protein