Ver mas grande
GDF5 (Human) Recombinant Protein
AB-P4393
Producto nuevo
GDF5 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | GDF5 |
| Gene Alias | BMP14|CDMP1|LAP4|SYNS2 |
| Gene Description | growth differentiation factor 5 |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC or lower.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | No additive |
| Gene ID | 8200 |
Más información
Human GDF5 (P43026) recombinant protein expressed in Escherichia coli.