FGF2 (Human) Recombinant Protein
  • FGF2 (Human) Recombinant Protein

FGF2 (Human) Recombinant Protein

Ref: AB-P4386
FGF2 (Human) Recombinant Protein

Información del producto

Human FGF2 (P09038) recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name FGF2
Gene Alias BFGF|FGFB|HBGF-2
Gene Description fibroblast growth factor 2 (basic)
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C or lower.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized from 10 mM Na2PO4, pH 8.0
Gene ID 2247

Enviar un mensaje


FGF2 (Human) Recombinant Protein

FGF2 (Human) Recombinant Protein