Ver mas grande
RARRES2 (Human) Recombinant Protein
AB-P4378
Producto nuevo
RARRES2 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | RARRES2 |
| Gene Alias | CHEMERIN|HP10433|TIG2 |
| Gene Description | retinoic acid receptor responder (tazarotene induced) 2 |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC or lower.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Storage Buffer | Lyophilized from 0.2% TFA |
| Gene ID | 5919 |
Más información
Human RARRES2 (Q99969) recombinant protein expressed in Escherichia coli.