ARTN (Human) Recombinant Protein
  • ARTN (Human) Recombinant Protein

ARTN (Human) Recombinant Protein

Ref: AB-P4372
ARTN (Human) Recombinant Protein

Información del producto

Human ARTN (Q5T4W7) recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name ARTN
Gene Alias ENOVIN|EVN|NBN
Gene Description artemin
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C or lower.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized from 10 mM sodium citrate, 25 mM NaCl, pH 4.5
Gene ID 9048

Enviar un mensaje


ARTN (Human) Recombinant Protein

ARTN (Human) Recombinant Protein