Ver mas grande
Il11 (Mouse) Recombinant Protein
AB-P4359
Producto nuevo
Il11 (Mouse) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | Il11 |
| Gene Alias | IL-11 |
| Gene Description | interleukin 11 |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from PBS. |
| Gene ID | 16156 |
Más información
Mouse Il11 (P47873, 22 a.a. - 199 a.a.) partial recombinant protein expressed in Escherichia coli.