Il10 (Mouse) Recombinant Protein Ver mas grande

Il10 (Mouse) Recombinant Protein

AB-P4358

Producto nuevo

Il10 (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name Il10
Gene Alias CSIF|Il-10
Gene Description interleukin 10
Storage Conditions Store at -20ºC on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLKCENKSKAVEQVKSDFNKLEDQGVYKAMNEFDIFINCIEAYMMIKMKS
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS, pH 7.0
Gene ID 16153

Más información

Mouse Il10 (P18893, 19 a.a. - 178 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Il10 (Mouse) Recombinant Protein

Il10 (Mouse) Recombinant Protein