Il1a (Mouse) Recombinant Protein
  • Il1a (Mouse) Recombinant Protein

Il1a (Mouse) Recombinant Protein

Ref: AB-P4356
Il1a (Mouse) Recombinant Protein

Información del producto

Mouse Il1a (P01582, 115 a.a. - 270 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Il1a
Gene Alias Il-1a
Gene Description interleukin 1 alpha
Storage Conditions Store at -20C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS
Gene ID 16175

Enviar un mensaje


Il1a (Mouse) Recombinant Protein

Il1a (Mouse) Recombinant Protein