Ver mas grande
Csf2 (Mouse) Recombinant Protein
AB-P4355
Producto nuevo
Csf2 (Mouse) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Csf2 |
| Gene Alias | Csfgm|Gm-CSf|MGC151255|MGC151257|MGI-IGM |
| Gene Description | colony stimulating factor 2 (granulocyte-macrophage) |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from PBS, pH 7.0. |
| Gene ID | 12981 |
Más información
Mouse Csf2 (P01587, 18 a.a. - 141 a.a.) partial recombinant protein expressed in Escherichia coli.