S100a4 (Mouse) Recombinant Protein
  • S100a4 (Mouse) Recombinant Protein

S100a4 (Mouse) Recombinant Protein

Ref: AB-P4344
S100a4 (Mouse) Recombinant Protein

Información del producto

Mouse S100a4 (NP_035441, 1 a.a. - 101 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name S100a4
Gene Alias 18A2|42a|Capl|FSp1|Mts1|PeL98|metastasin|pk9a
Gene Description S100 calcium binding protein A4
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK
Form Liquid
Antigen species Target species Mouse
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (20% glycerol, 2 mM DTT).
Gene ID 20198

Enviar un mensaje


S100a4 (Mouse) Recombinant Protein

S100a4 (Mouse) Recombinant Protein