Lypla1 (Mouse) Recombinant Protein
  • Lypla1 (Mouse) Recombinant Protein

Lypla1 (Mouse) Recombinant Protein

Ref: AB-P4342
Lypla1 (Mouse) Recombinant Protein

Información del producto

Mouse Lypla1 (NP_032892, 1 a.a. - 230 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Lypla1
Gene Alias Pla1a
Gene Description lysophospholipase 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID
Form Liquid
Antigen species Target species Mouse
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (10% glycerol, 1 mM DTT).
Gene ID 18777

Enviar un mensaje


Lypla1 (Mouse) Recombinant Protein

Lypla1 (Mouse) Recombinant Protein